Overview

  • Product name
    Recombinant Human AMBN protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQL GSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRPREHETQQYE YSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHL GHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQ LNAPARLGIMSSEEVAGGREDPMAYGAMFPGFGGMRPGFEGMPHNPAMGG DFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPH AGLLALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHDAWHFQEP
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 447

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMBN
    • AMBN_HUMAN
    • Ameloblastin
    • Ameloblastin (enamel matrix protein)
  • Function
    Involved in the mineralization and structural organization of enamel.
  • Tissue specificity
    Ameloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel.
  • Sequence similarities
    Belongs to the ameloblastin family.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116972 at approximately 75.25kDa.
    Stained with Coomassie Blue.

References

ab116972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up