Overview

  • Product name
    Recombinant Human AMBN protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQL GSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRPREHETQQYE YSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHL GHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQ LNAPARLGIMSSEEVAGGREDPMAYGAMFPGFGGMRPGFEGMPHNPAMGG DFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPH AGLLALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHDAWHFQEP
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 447

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMBN
    • AMBN_HUMAN
    • Ameloblastin
    • Ameloblastin (enamel matrix protein)
  • Function
    Involved in the mineralization and structural organization of enamel.
  • Tissue specificity
    Ameloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel.
  • Sequence similarities
    Belongs to the ameloblastin family.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human AMBN protein images

  • 12.5% SDS-PAGE showing ab116972 at approximately 75.25kDa.
    Stained with Coomassie Blue.

References for Recombinant Human AMBN protein (ab116972)

ab116972 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up