Overview

  • Product nameRecombinant Human AMBN protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9NP70
    • SpeciesHuman
    • SequenceMSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMASLSLETMRQL GSLQRLNTLSQYSRYGFGKSFNSLWMHGLLPPHSSLPWMRPREHETQQYE YSLPVHPPPLPSQPSLKPQQPGLKPFLQSAAATTNQATALKEALQPPIHL GHLPLQEGELPLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPGMLYVPFGANQ LNAPARLGIMSSEEVAGGREDPMAYGAMFPGFGGMRPGFEGMPHNPAMGG DFTLEFDSPVAATKGPENEEGGAQGSPMPEANPDNLENPAFLTELEPAPH AGLLALPKDDIPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHDAWHFQEP
    • Molecular weight75 kDa including tags
    • Amino acids1 to 447

Specifications

Our Abpromise guarantee covers the use of ab116972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMBN
    • AMBN_HUMAN
    • Ameloblastin
    • Ameloblastin (enamel matrix protein)
  • FunctionInvolved in the mineralization and structural organization of enamel.
  • Tissue specificityAmeloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel.
  • Sequence similaritiesBelongs to the ameloblastin family.
  • Cellular localizationSecreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human AMBN protein images

  • 12.5% SDS-PAGE showing ab116972 at approximately 75.25kDa.
    Stained with Coomassie Blue.

References for Recombinant Human AMBN protein (ab116972)

ab116972 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"