Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYP SYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPM MPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQ PLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 191

Specifications

Our Abpromise guarantee covers the use of ab114629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI1E
    • AIH1
    • ALGN
    • Amel
    • Amelogenesis imperfecta 1
    • Amelogenin
    • Amelogenin (amelogenesis imperfecta 1, X linked)
    • Amelogenin (X chromosome)
    • Amelogenin (X chromosome, amelogenesis imperfecta 1)
    • Amelogenin X isoform
    • Amelogenin, X linked
    • AMELX
    • AMELX_HUMAN
    • Amg
    • AMGL
    • AMGX
    • OTTHUMP00000022906
    • OTTHUMP00000022907
    • X isoform
    see all
  • Function
    Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.
  • Involvement in disease
    Defects in AMELX are the cause of amelogenesis imperfecta hypoplastic type 1 (AIH1) [MIM:301200]. AIH1 is a X-linked defect of dental enamel formation. Teeth have only a thin layer of enamel with normal hardness. The thinness of the enamel makes the teeth appear small.
  • Sequence similarities
    Belongs to the amelogenin family.
  • Developmental stage
    Transiently but abundantly expressed by ameloblasts during tooth development. Amelogenin is the predominant protein in developing dental enamel.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab114629 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up