Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYP SYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPM MPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQ PLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 191

Specifications

Our Abpromise guarantee covers the use of ab114629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI1E
    • AIH1
    • ALGN
    • Amel
    • Amelogenesis imperfecta 1
    • Amelogenin
    • Amelogenin (amelogenesis imperfecta 1, X linked)
    • Amelogenin (X chromosome)
    • Amelogenin (X chromosome, amelogenesis imperfecta 1)
    • Amelogenin X isoform
    • Amelogenin, X linked
    • AMELX
    • AMELX_HUMAN
    • Amg
    • AMGL
    • AMGX
    • OTTHUMP00000022906
    • OTTHUMP00000022907
    • X isoform
    see all
  • Function
    Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.
  • Involvement in disease
    Defects in AMELX are the cause of amelogenesis imperfecta hypoplastic type 1 (AIH1) [MIM:301200]. AIH1 is a X-linked defect of dental enamel formation. Teeth have only a thin layer of enamel with normal hardness. The thinness of the enamel makes the teeth appear small.
  • Sequence similarities
    Belongs to the amelogenin family.
  • Developmental stage
    Transiently but abundantly expressed by ameloblasts during tooth development. Amelogenin is the predominant protein in developing dental enamel.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Recombinant Human AMELX protein images

  • ab114629 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human AMELX protein (ab114629)

ab114629 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up