Overview

  • Product name
    Recombinant Human AMFR protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQV PFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      451 to 550

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMF receptor
    • AMF receptor isoform 1
    • AMF receptor isoform 2
    • AMFR
    • AMFR2_HUMAN
    • Autocrine motility factor receptor
    • Autocrine motility factor receptor precursor, isoform 1
    • Autocrine motility factor receptor precursor, isoform 2
    • E3 ubiquitin-protein ligase AMFR
    • gp78
    • isoform 2
    • RING finger protein 45
    • RNF 45
    • RNF45
    see all
  • Function
    E3 ubiquitin-protein ligase which can target both itself and other proteins including CD3D and APOB for proteasomal degradation. Mediates polyubiquitination of CYP3A4. Specific receptor for the autocrine motility factor. Mediates tumor invasion and metastasis. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulun that are retrotranslocated in the cytosol. Promotes ubiquitination of misfolded proteins such as mutant CFTR; proposed to mediate sequential ubiquitination by recognizing already ubiquitin-conjugated substrates and to cooperate with E3 ubiquitin-protein ligase RNF5.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 CUE domain.
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114887 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References

ab114887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up