Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATN LVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA
    • Amino acids
      188 to 287
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5430437E11Rik
    • aifm2
    • AIFM2_HUMAN
    • AMID
    • Apoptosis inducing factor (AIF) homologous mitochondrion associated inducer of death
    • Apoptosis inducing factor (AIF) like mitochondrion associated inducer of death
    • Apoptosis inducing factor mitochondrion associated 2
    • Apoptosis-inducing factor 2
    • Apoptosis-inducing factor homologous mitochondrion-associated inducer of death
    • Apoptosis-inducing factor-like mitochondrion-associated inducer of death
    • Cys51Stop
    • HGNC11998
    • p53 responsive gene 3
    • p53 tumor suppressor
    • p53-responsive gene 3 protein
    • PRG3
    • TRP53
    • Tumor protein p53
    see all
  • Function
    Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death. Binds to DNA in a sequence-independent manner. May contribute to genotoxin-induced growth arrest.
  • Tissue specificity
    Detected in most normal tissues as two transcripts of 1.8 and 4.0 kb in length, respectively. Highly expressed in heart, moderately in liver and skeletal muscles, and expressed at low levels in placenta, lung, kidney, and pancreas. Both transcripts expressed following p53/TP53 induction. The shorter 1.8 kb transcript seems to be the major transcript in EB1 colon cancer cells.
  • Sequence similarities
    Belongs to the FAD-dependent oxidoreductase family.
  • Cellular localization
    Cytoplasm. Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab164677 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up