Recombinant Human AMIGO2 protein (ab166332)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATD IVSCTNKNLSKVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAKLNTLIL RHNNITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQELKVLEVLLLYN NHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVS YNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDCSLYSLLVFWYRRHFSS VMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHEA QVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVI ESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAF TTLAACVASIVLVLLYLYLTPCPCKCKTKRQKNMLHQSNAHSSILSPGPA SDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKST RGKSDSDSVNSVFSDTPFVAST
    • Amino acids
      1 to 522
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adhesion molecule with Ig like domain 2
    • ALI 1
    • ALI1
    • Alivin 1
    • Alivin-1
    • Alivin1
    • AMGO2_HUMAN
    • AMIGO 2
    • AMIGO-2
    • Amigo2
    • Amphoterin induced gene 2
    • Amphoterin induced protein 2
    • Amphoterin-induced gene and open reading frame 2
    • Amphoterin-induced protein 2
    • DEGA
    • Differentially expressed in gastric adenocarcinoma
    • Differentially expressed in gastric adenocarcinomas
    • Transmembrane protein AMIGO 2
    • Transmembrane protein AMIGO2
    see all
  • Function
    Required for depolarization-dependent survival of cultured cerebellar granule neurons. May mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. May contribute to signal transduction through its intracellular domain. May be required for tumorigenesis of a subset of gastric adenocarcinomas.
  • Tissue specificity
    Highest levels in breast, ovary, cervix, and uterus. Lower levels in lung, colon, and rectum. Differentially expressed in 56% of thyroid, 57% of pancreatic and 45% of stomach cancers.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. AMIGO family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 LRRNT domain.
  • Cellular localization
    Cell membrane. Nucleus. Associated with nucleus as well as plasma membrane. Restricted to somata of cerebellar as well as hippocampal neurons.
  • Information by UniProt

Images

  • ab166332 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up