Recombinant Human Amino-terminal enhancer of split protein (ab104756)

Overview

  • Product nameRecombinant Human Amino-terminal enhancer of split protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ08117
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMMFPQSRHSGSSHLPQQLKFTTSDSCDRIK DEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAE IVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAH QLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDK NGHDGDTHQEDDGEKSD
    • Molecular weight24 kDa including tags
    • Amino acids1 to 197
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104756 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • aes
    • Aes 1
    • Aes 2
    • AES_HUMAN
    • Aes1
    • Aes2
    • Amino enhancer of split
    • Amino terminal enhancer of split
    • Amino-terminal enhancer of split
    • Esp 1
    • Esp1
    • Gp130 associated protein GAM
    • Gp130-associated protein GAM
    • GRG
    • GRG 5
    • GRG protein
    • Grg-5
    • GRG5
    • Groucho-related protein 5
    • Protein ESP 1
    • Protein ESP1
    • Protein GRG
    • TLE 5
    • TLE5
    see all
  • FunctionTranscriptional corepressor. Acts as dominant repressor towards other family members. Inhibits NF-kappa-B-regulated gene expression. May be required for the initiation and maintenance of the differentiated state. Essential for the transcriptional repressor activity of SIX3 during retina and lens development.
  • Tissue specificityFound predominantly in muscle, heart and Placenta. In fetal tissues, abundantly expressed in the heart, lung, kidney, brain and liver.
  • Sequence similaritiesBelongs to the WD repeat Groucho/TLE family.
  • DomainLacks the C-terminal WD repeats.
  • Post-translational
    modifications
    Ubiquitinated by XIAP/BIRC4.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Amino-terminal enhancer of split protein images

  • 15% SDS-PAGE (3µg).

References for Recombinant Human Amino-terminal enhancer of split protein (ab104756)

ab104756 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"