Recombinant Human Aminoacylase 1 protein (ab99247)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTSKGPEEEHPSVTLFRQYLRIRTVQPKPD YGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSH TDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKV EGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP TDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFR EKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPD VDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRV CKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLH EAVFLRGVDIYTRLLPALASVPALPSDS
    • Molecular weight
      48 kDa including tags
    • Amino acids
      1 to 408
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99247 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ACY 1
    • ACY-1
    • Acy1
    • ACY1_HUMAN
    • ACY1D
    • ACYLASE
    • Acylase I
    • Aminoacylase-1
    • EC 3.5.1.14
    • epididymis secretory protein Li 5
    • HEL-S-5
    • N acyl L amino acid amidohydrolase
    • N-acyl-L-amino-acid amidohydrolase
    • OTTHUMP00000212459
    • OTTHUMP00000212462
    • OTTHUMP00000212463
    • OTTHUMP00000212464
    • OTTHUMP00000212465
    see all
  • Function
    Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).
  • Tissue specificity
    Expression is highest in kidney, strong in brain and weaker in placenta and spleen.
  • Involvement in disease
    Defects in ACY1 are the cause of aminoacylase-1 deficiency (ACY1D) [MIM:609924]. ACY1D results in a metabolic disorder manifesting with encephalopathy, unspecific psychomotor delay, psychomotor delay with atrophy of the vermis and syringomyelia, marked muscular hypotonia or normal clinical features. Epileptic seizures are a frequent feature. All affected individuals exhibit markedly increased urinary excretion of several N-acetylated amino acids.
  • Sequence similarities
    Belongs to the peptidase M20A family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human Aminoacylase 1 protein images

  • 15% SDS-PAGE showing ab99247 (3µg).

References for Recombinant Human Aminoacylase 1 protein (ab99247)

ab99247 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up