Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ01433
    • SpeciesHuman
    • SequenceISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLE REFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
    • Molecular weight37 kDa including tags
    • Amino acids86 to 185

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenosine monophosphate deaminase 2
    • Adenosine monophosphate deaminase 2 (isoform L)
    • adenosine monophosphate deaminase 2 isoform L
    • AMP deaminase 2
    • AMP deaminase isoform L
    • AMPD
    • AMPD 2
    • AMPD2
    • AMPD2_HUMAN
    • RP5-1160K1.5
    • SPG63
    see all
  • FunctionAMP deaminase plays a critical role in energy metabolism.
  • Tissue specificityThree isoforms are present in mammals: AMP deaminase 1 is the predominant form in skeletal muscle; AMP deaminase 2 predominates in smooth muscle, non-muscle tissue, embryonic muscle and undifferentiated myoblasts; AMP deaminase 3 is found in erythrocytes.
  • PathwayPurine metabolism; IMP biosynthesis via salvage pathway; IMP from AMP: step 1/1.
  • Sequence similaritiesBelongs to the adenosine and AMP deaminases family.
  • Information by UniProt

Recombinant Human AMPD2 protein images

  • 12.5% SDS-PAGE showing ab116904 at approximately 36.63 kDa stained with Coomassie Blue.

References for Recombinant Human AMPD2 protein (ab116904)

ab116904 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"