Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLE REFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      86 to 185

Specifications

Our Abpromise guarantee covers the use of ab116904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenosine monophosphate deaminase 2
    • Adenosine monophosphate deaminase 2 (isoform L)
    • adenosine monophosphate deaminase 2 isoform L
    • AMP deaminase 2
    • AMP deaminase isoform L
    • AMPD
    • AMPD 2
    • AMPD2
    • AMPD2_HUMAN
    • RP5-1160K1.5
    • SPG63
    see all
  • Function
    AMP deaminase plays a critical role in energy metabolism.
  • Tissue specificity
    Three isoforms are present in mammals: AMP deaminase 1 is the predominant form in skeletal muscle; AMP deaminase 2 predominates in smooth muscle, non-muscle tissue, embryonic muscle and undifferentiated myoblasts; AMP deaminase 3 is found in erythrocytes.
  • Pathway
    Purine metabolism; IMP biosynthesis via salvage pathway; IMP from AMP: step 1/1.
  • Sequence similarities
    Belongs to the adenosine and AMP deaminases family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116904 at approximately 36.63 kDa stained with Coomassie Blue.

References

ab116904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up