Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP15514
    • SpeciesHuman
    • SequenceSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEF QNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
    • Molecular weight11 kDa
    • Amino acids101 to 198

Specifications

Our Abpromise guarantee covers the use of ab104355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityDetermined by its ability to stimulate the proliferation of mouse Balb/c 3T3 cells. The expected ED50 for this effect is 5-10 ng/ml.
  • Applications

    SDS-PAGE

    Functional Studies

    Western blot

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 95 % SDS-PAGE.
    Purity is > 95% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    Preservative: None
    Constituents: 5mM Sodium phosphate, pH 7.0

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • A REG
    • Amphiregulin
    • Amphiregulin B
    • AR
    • AREG
    • AREG_HUMAN
    • AREGB
    • Colorectum cell derived growth factor
    • Colorectum cell-derived growth factor
    • CRDGF
    • MGC13647
    • Schwannoma derived growth factor
    • SDGF
    see all
  • FunctionBifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells.
  • Sequence similaritiesBelongs to the amphiregulin family.
    Contains 1 EGF-like domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant human Amphiregulin protein images

  • Anti-Amphiregulin antibody [MM0089-8K16] (ab89119) at 1/500 dilution + Recombinant human Amphiregulin protein (ab104355) at 0.1 µg

    Secondary
    Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 8 minutes

References for Recombinant human Amphiregulin protein (ab104355)

This product has been referenced in:
  • Hobor S  et al. TGFa and amphiregulin paracrine network promotes resistance to EGFR blockade in colorectal cancer cells. Clin Cancer Res 20:6429-38 (2014). Read more (PubMed: 24916700) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab104355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"