Recombinant human Amphiregulin protein (Animal Free) (ab229598)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 95% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human Amphiregulin protein (Animal Free)
See all Amphiregulin proteins and peptides -
Biological activity
3T3 Cell Proliferation.
ED50 ≤ 20 ng/ml (≥ 5.0 x 104 units/mg).
-
Purity
>= 95 % SDS-PAGE.
Purity determined by reducing and non-reducing SDS-PAGE. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEF QNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK -
Predicted molecular weight
10 kDa -
Amino acids
101 to 187 -
Additional sequence information
This product is the mature full length protein from aa 101 to 187. The signal peptide and propeptide are not included.
-
Specifications
Our Abpromise guarantee covers the use of ab229598 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 0.16% Sodium phosphate
Lyophilized from a sterile (0.2 micron) filtered aqueous solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- A REG
- Amphiregulin
- Amphiregulin B
see all -
Function
Bifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells. -
Sequence similarities
Belongs to the amphiregulin family.
Contains 1 EGF-like domain. -
Cellular localization
Membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab229598 has not yet been referenced specifically in any publications.