Recombinant human AMPK alpha 1 + AMPK beta 2 + AMPK gamma 3 protein (Active) (ab184885)

Overview

  • Product name
    Recombinant human AMPK alpha 1 + AMPK beta 2 + AMPK gamma 3 protein (Active)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Species
      Human
    • Tags
      His tag C-Terminus , proprietary tag N-Terminus
    • Additional sequence information
      Recombinant full length AMPK alpha 1 (a.a's 1-559 of UniProt ID: Q13131) + AMPK beta 2 (a.a's 1-272 of UniProt ID: O43741) + AMPK gamma 3 (a.a.'s 1- 489 of UniProt ID:Q9UGI9). MWt 92, 62, and 108 KDa.

Specifications

Our Abpromise guarantee covers the use of ab184885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab184885 was determined to be 400 nmol/min/mg

  • Applications

    Functional Studies

    SDS-PAGE

    Western blot

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Additional notes

    Q13131
    MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ

    O43741
    MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

    Q9UGI9
    MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTLIKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS PAGIDALGA

    ab204881 (Acetyl Coenzyme A Carboxylase peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5 AMP activated protein kinase alpha 1catalytic subunit
    • 5 AMP activated protein kinase catalytic alpha 1 chain
    • 5 AMP activated protein kinase subunit gamma 3
    • 5' AMP activated protein kinase beta 2 subunit
    • 5' AMP activated protein kinase catalytic subunit alpha 1
    • 5' AMP activated protein kinase catalytic subunit alpha-1
    • 5' AMP activated protein kinase subunit beta 2
    • 5' AMP activated protein kinase subunit beta-2
    • AAPK1
    • Acetyl CoA carboxylase kinase
    • AMP -activate kinase alpha 1 subunit
    • AMP activated protein kinase beta 2 non catalytic subunit
    • AMP-activated protein kinase, catalytic, alpha -1
    • AMP-activated protein kinase, catalytic, alpha1
    • AMPK
    • AMPK 1
    • AMPK alpha 1
    • AMPK alpha 1 chain
    • AMPK beta 2
    • AMPK beta 2 chain
    • AMPK gamma 3
    • AMPK gamma 3 chain
    • AMPK gamma3
    • AMPK subunit alpha 1
    • AMPK subunit alpha-1
    • AMPK subunit gamma 3
    • AMPK subunit gamma3
    • AMPK1
    • AMPKa1
    • AMPKalpha1
    • AMPKG3
    • HMG CoA reductase kinase
    • Hormone sensitive lipase kinase
    • Kinase AMPK alpha1
    • PRKAA 1
    • PRKAA1
    • PRKAB 2
    • Prkab2
    • PRKAG3
    • Protein kinase AMP activated alpha 1 catalytic subunit
    • Protein kinase AMP activated beta 2 non catalytic subunit
    • Protein kinase AMP activated gamma 3 non catalytic subunit
    • SNF1-like protein AMPK
    • SNF1A
    • Tau protein kinase PRKAA1
    see all
  • Relevance
    AMPK alpha 1: Responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. It also regulates cholesterol synthesis via phosphorylation and inactivation of hormone-sensitive lipase and hydroxymethylglutaryl-CoA reductase. Appears to act as a metabolic stress-sensing protein kinase switching off biosynthetic pathways when cellular ATP levels are depleted and when 5'-AMP rises in response to fuel limitation and/or hypoxia. This is a catalytic subunit. AMPK beta 2: AMPK is responsible for the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase. Also regulates cholesterol synthesis via phosphorylation and inactivation of hydroxymethylglutaryl-CoA reductase and hormone-sensitive lipase. This is a regulatory subunit, may be a positive regulator of AMPK activity. It may also serve as an adapter molecule for the catalytic alpha-subunit. AMPK gamma 3: AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • Kinase Assay demonstrating specific activity of ab184885.

  • SDS-PAGE showing ab184885, approx MW ~92 kDa (A1), ~62 kDa (B2) and ~108 kDa (G3).

References

ab184885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up