Recombinant human AMPK alpha 2 + beta 1 + gamma 2 protein (ab185258)

Overview

  • Product name
    Recombinant human AMPK alpha 2 + beta 1 + gamma 2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Species
      Human
    • Tags
      His tag C-Terminus , proprietary tag N-Terminus
    • Additional sequence information
      Recombinant full length AMPK alpha 2 (aa 1-552; UniProt P54646) + AMPK beta 1 (aa 1-270; UniProt Q9Y478) + AMPK gamma 2 Isoform C (aa 1-525; UniProt Q9UGJ0-3). MWt 92, 65, and 105 kDa respectively.

Specifications

Our Abpromise guarantee covers the use of ab185258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab185258 was determined to be 350 nmol/min/mg.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    Assessed by densitometry.
  • Form
    Liquid
  • Additional notes

    AMPK alpha 2 (amino acids: 1-552; UniProt P54646)

    MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR

    AMPK beta 1 (amino acids 1-270; UniProt Q9Y478)

    MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

    AMPK gamma 2 Isoform C (amino acids 1-525; UniProt Q9UGJ0-3)
    MPLLDGDLEGSGKHSSRKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGAKQKETETE

    ab204881 (Acetyl Coenzyme A Carboxylase peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5' AMP activated protein kinase beta 1 subunit
    • 5' AMP activated protein kinase catalytic alpha 2 chain
    • 5' AMP activated protein kinase catalytic subunit alpha 2
    • 5' AMP activated protein kinase subunit beta 1
    • 5' AMP activated protein kinase subunit gamma 2
    • AAKG
    • AAKG2
    • ACACA kinase
    • Acetyl CoA carboxylase kinase
    • AMP activated protein kinase beta subunit
    • AMPK
    • AMPK alpha 2 chain
    • AMPK beta 1
    • AMPK beta1 chain
    • AMPK subunit alpha 2
    • AMPK subunit beta 1
    • AMPK subunit gamma 2
    • AMPK2
    • AMPKa2
    • AMPKb
    • H91620p
    • HAMPKb
    • HMGCR kinase
    • Hydroxymethylglutaryl CoA reductase kinase
    • PRKAA
    • PRKAA2
    • PRKAB1
    • PRKAG2
    • Protein kinase AMP activated alpha 2 catalytic subunit
    • Protein kinase AMP activated beta 1 non catalytic subunit
    • Protein kinase AMP activated gamma 2 non catalytic subunit
    • Protein kinase AMP activated noncatalytic beta 1
    • WPWS
    see all

Images

  • SDS-PAGE analysis of ab185258.

  • Kinase Assay showing the specific activity of ab185258 as 350 nmol/min/mg.

References

ab185258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up