Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf21 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIY SEEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAF PKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVA QQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL EKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPT IDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVL IPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLH THCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSK DPPLFCSCSHVTVVDRAVTITDLR
    • Molecular weight
      48 kDa
    • Amino acids
      1 to 424

Specifications

Our Abpromise guarantee covers the use of ab188712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Binds STAM protein with Kd = ~7 µM. In in vitro assays containing 200 nM AMSH, a ~10-fold increase in the rate of hydrolysis of K63-linked diubiquitin FRET substrate was achieved upon the addition of STAM. Half-maximal increase occurred at 0.4 µM STAM.

    Typical enzyme concentration for use in vitro ranges from 100-500 nM depending on conditions and substrate. Suggested Reaction Buffer for plate-based assays is 50 mM Hepes, pH 8.0, 100 mM NaCl, and 0.1 mg/ml BSA. AMSH activity is partially or fully inhibited by DTT at concentrations above 1 mM.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 1.19% HEPES, 10% Glycerol, 0.87% Sodium chloride, 0.03% TCEP

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • AMSH
    • Associated molecule with the SH3 domain of STAM
    • Endosome associated ubiquitin isopeptidase
    • Endosome-associated ubiquitin isopeptidase
    • MGC126516
    • MGC126518
    • MICCAP
    • STABP_HUMAN
    • STAM binding protein
    • STAM-binding protein
    • Stambp
    see all
  • Function
    Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains (By similarity). Functions at the endosome and is able to oppose the ubiquitin-dependent sorting of receptors to lysosomes. Plays a role in signal transduction for cell growth and MYC induction mediated by IL-2 and GM-CSF. Potentiates BMP (bone morphogenetic protein) signaling by antagonizing the inhibitory action of SMAD6 and SMAD7.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the peptidase M67C family.
    Contains 1 MPN (JAB/Mov34) domain.
  • Domain
    The JAMM motif is essential for the protease activity.
  • Post-translational
    modifications
    Phosphorylated after BMP type I receptor activation.
    Ubiquitinated by SMURF2 in the presence of RNF11.
  • Cellular localization
    Nucleus. Membrane. Cytoplasm. Early endosome.
  • Information by UniProt

References

ab188712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up