Recombinant Human Angiopoietin-like 4/ANGPTL4 protein (His tag) (ab191677)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Angiopoietin-like 4/ANGPTL4 protein (His tag)
See all Angiopoietin-like 4/ANGPTL4 proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab191677 is lyophilized from 0.22 µm filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVN CKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSI TGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGAT TVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFR SIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS -
Predicted molecular weight
28 kDa including tags -
Molecular weight information
The protein has a calculated MW of 27.9 kDa. The protein migrates as 31-35 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. -
Amino acids
166 to 406 -
Tags
His tag N-Terminus -
Additional sequence information
NP_647475
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab191677 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as Angiopoietin-like 4
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 1.045% MOPS, 0.58% Sodium chloride, 0.1% CHAPS
5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5% -
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- Angiopoietin like 4
- Angiopoietin related protein 4
- Angiopoietin-like protein 4
see all -
Function
Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorgenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation. -
Tissue specificity
Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney. -
Sequence similarities
Contains 1 fibrinogen C-terminal domain. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Secreted. Secreted > extracellular space > extracellular matrix. The unprocessed form interacts with the extracellular matrix. This may constitute a dynamic reservoir, a regulatory mechanism of the bioavailability of ANGPTL4. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab191677 has not yet been referenced specifically in any publications.