Recombinant Human Angiopoietin-like 4 protein (ab191677)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVN CKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSI TGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGAT TVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFR SIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
    • Molecular weight
      28 kDa including tags
    • Amino acids
      166 to 406
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_647475

Specifications

Our Abpromise guarantee covers the use of ab191677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab191677 is lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 1.045% MOPS, 0.58% Sodium chloride, 0.1% CHAPS

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Angiopoietin like 4
    • Angiopoietin related protein 4
    • Angiopoietin-like protein 4
    • Angiopoietin-related protein 4
    • ANGL4_HUMAN
    • ANGPT L2
    • ANGPT L4
    • ANGPTL2
    • Angptl4
    • ARP4
    • Fasting induced adipose factor
    • FIAF
    • HARP
    • Hepatic angiopoietin related protein
    • Hepatic fibrinogen/angiopoietin related protein
    • Hepatic fibrinogen/angiopoietin-related protein
    • HFARP
    • NL2
    • Peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin related protein
    • PGAR
    • pp1158
    • PPARG angiopoietin related protein
    • PSEC0166
    • TGQTL
    • UNQ171
    • Weakly similar to angiopoietin 1 [H.sapiens]
    see all
  • Function
    Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorgenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation.
  • Tissue specificity
    Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney.
  • Sequence similarities
    Contains 1 fibrinogen C-terminal domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted. Secreted > extracellular space > extracellular matrix. The unprocessed form interacts with the extracellular matrix. This may constitute a dynamic reservoir, a regulatory mechanism of the bioavailability of ANGPTL4.
  • Information by UniProt

Images

  • DTT- reduced SDS-PAGE analysis of ab191677, stained overnight with Coomassie Blue. The DTT-reduced protein migrates as 33-36 kDa due to glycosylation.

References

ab191677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up