Recombinant Human Angiotensin Converting Enzyme 1 protein (ab158266)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELH GEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQA RGTREAPVYM
    • Amino acids
      592 to 701
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158266 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACE
    • ACE 1
    • ACE T
    • ACE_HUMAN
    • ACE1
    • Angiotensin converting enzyme somatic isoform
    • Angiotensin converting enzyme testis specific isoform
    • Angiotensin I converting enzyme
    • Angiotensin I converting enzyme 1
    • Angiotensin I converting enzyme peptidyl dipeptidase A 1
    • angiotensin I converting enzyme peptidyl-dipeptidase A 1 transcript
    • Angiotensin-converting enzyme
    • Carboxycathepsin
    • CD 143
    • CD143
    • CD143 antigen
    • DCP
    • DCP 1
    • DCP1
    • Dipeptidyl carboxypeptidase 1
    • Dipeptidyl carboxypeptidase I
    • Kininase II
    • MGC26566
    • MVCD3
    • Peptidase P
    • Peptidyl dipeptidase A
    • soluble form
    • Testicular ECA
    see all
  • Function
    Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety.
  • Tissue specificity
    Ubiquitously expressed, with highest levels in lung, kidney, heart, gastrointestinal system and prostate. Isoform Testis-specific is expressed in spermatocytes and adult testis.
  • Involvement in disease
    Ischemic stroke (ISCHSTR) [MIM:601367]: A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Renal tubular dysgenesis (RTD) [MIM:267430]: Autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). Note=The disease is caused by mutations affecting the gene represented in this entry.
    Microvascular complications of diabetes 3 (MVCD3) [MIM:612624]: Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
    Intracerebral hemorrhage (ICH) [MIM:614519]: A pathological condition characterized by bleeding into one or both cerebral hemispheres including the basal ganglia and the cerebral cortex. It is often associated with hypertension and craniocerebral trauma. Intracerebral bleeding is a common cause of stroke. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the peptidase M2 family.
  • Post-translational
    modifications
    Phosphorylated by CK2 on Ser-1299; which allows membrane retention.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab158266 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158266 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158266.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up