Recombinant Human Angiotensin II Type 2 Receptor protein (ab157871)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPIL YYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLW ATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPF LSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFP PEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRIT RDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCR KSSSLREMETFVS
    • Amino acids
      1 to 363
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Blocking

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGTR 2
    • Agtr2
    • AGTR2_HUMAN
    • angiotensin II receptor type 2
    • Angiotensin II type-2 receptor
    • Angiotensin receptor 2
    • AT 2
    • AT2
    • ATGR 2
    • ATGR2
    • MRX 88
    • MRX88
    • Type 2 angiotensin II receptor
    • Type-2 angiotensin II receptor
    see all
  • Function
    Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.
  • Tissue specificity
    In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Very highly expressed in fetal kidney and intestine.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab157871 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Silva PA  et al. Mechanisms involving Ang II and MAPK/ERK1/2 signaling pathways underlie cardiac and renal alterations during chronic undernutrition. PLoS One 9:e100410 (2014). Blocking . Read more (PubMed: 24983243) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up