Recombinant Human Angiotensinogen protein (ab191974)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKA LQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATV LSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSA LQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPV VLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLTGASVDSTLAFNTYVH FQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQ VSFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQ LVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELE ADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLS TAVDHHHHHH
    • Molecular weight
      51 kDa including tags
    • Amino acids
      34 to 485
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Aangiotensinogen (serpin peptidase inhibitor clade A member 8)
    • AGT
    • AI265500
    • Alpha 1 antiproteinase antitrypsin
    • Ang
    • Ang I
    • Ang II
    • Ang III
    • AngII
    • Angiotensin I
    • Angiotensin II
    • Angiotensin III
    • Angiotensin-3
    • Angiotensinogen
    • Angiotensinogen (PAT)
    • ANGT_HUMAN
    • ANHU
    • ANRT
    • AT-2
    • AT-II
    • Des-Asp[1]-angiotensin II
    • FLJ92595
    • FLJ97926
    • MGC105326
    • PAT
    • Pre angiotensinogen
    • Serine (or cysteine) proteinase inhibitor
    • Serpin A8
    • Serpin peptidase inhibitor clade A member 8
    • SERPINA8
    see all
  • Function
    Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2.
    Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.
    Angiotensin-3 stimulates aldosterone release.
    Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Involvement in disease
    Genetic variations in AGT are a cause of susceptibility to essential hypertension (EHT) [MIM:145500]. Essential hypertension is a condition in which blood pressure is consistently higher than normal with no identifiable cause.
    Defects in AGT are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
  • Sequence similarities
    Belongs to the serpin family.
  • Post-translational
    modifications
    Beta-decarboxylation of Asp-34 in angiotensin-2, by mononuclear leukocytes produces alanine. The resulting peptide form, angiotensin-A, has the same affinity for the AT1 receptor as angiotensin-2, but a higher affinity for the AT2 receptor.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab191974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up