Recombinant Human ANGPTL7 protein (ab160886)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVK ELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAES KYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPD DFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRG DFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLF LGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTD SNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP
    • Amino acids
      1 to 346
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Angiopoietin like 7
    • Angiopoietin like factor
    • Angiopoietin like factor (CDT6)
    • Angiopoietin related protein 7
    • Angiopoietin-like factor
    • Angiopoietin-like protein 7
    • Angiopoietin-related protein 7
    • ANGL7_HUMAN
    • ANGPTL7
    • AngX
    • CDT6
    • Cornea derived transcript 6 protein
    • Cornea-derived transcript 6 protein
    • dJ647M16.1
    • OTTHUMP00000001986
    • RP4-647M16.2
    see all
  • Tissue specificity
    Highly and specifically expressed in the cornea where is confined to the stromal layer.
  • Sequence similarities
    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab160886 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up