Overview

  • Product name
    Recombinant Human ANKH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVKFPALTHYWPLIRFLVPLGITNIAIDFGEQALNRGIAAVKEDAVEMLA SYGLAYSLMKFFTGPMSDFKNVGLVFVNSKRDRTKAVLCMVVAGAIAAVF HTLIAYSDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAG ILLKHKYSFLVGCASISDVIAQVVFVAILLHSHLECREPLLIPILSLYMG ALVRCTTLCLGYYKNIHDIIPDRSGPELGGDATIRKMLSFWWPLALILAT QRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVY PAFDKNNPSNKLVSTSNTVTAAHIKKFTFVCMALSLTLCFVMFWTPNVSE KILIDIIGVDFAFAELCVVPLRIFSFFPVPVTVRAHLTGWLMTLKKTFVL APSSVLRIIVLIASLVVLPYLGVHGATLGVGSLLAGFVGESTMVAIAACY VYRKQKKKMENESATEGEDSAMTDMPPTEEVTDIVEMREENE
    • Amino acids
      1 to 492
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANK
    • ANKH
    • ANKH_HUMAN
    • Ankylosis progressive homolog
    • Ankylosis progressive homolog (mouse)
    • CCAL 2
    • CCAL2
    • CMDJ
    • CPPDD
    • Craniometaphyseal dysplasia Jackson type (dominant)
    • FLJ27166
    • HANK
    • MANK
    • Progressive ankylosis protein homolog
    see all
  • Function
    Regulates intra- and extracellular levels of inorganic pyrophosphate (PPi), probably functioning as PPi transporter.
  • Tissue specificity
    Found in osteoblasts from mandibular bone and from iliac bone; not detected in osteoclastic cells.
  • Involvement in disease
    Chondrocalcinosis 2
    Craniometaphyseal dysplasia, autosomal dominant
  • Sequence similarities
    Belongs to the ANKH family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163357 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up