Recombinant Human ANKHD1 protein (ab162876)

Overview

  • Product name
    Recombinant Human ANKHD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLTDSGGGGTSFEEDLDSVAPRSAPAGASEPPPPGGVGLGIRTVRLFGEA GPASGVGSSGGGGSGSGTGGGDAALDFKLAAAVLRTGGGGGASGSDEDEV SEVESFILDQEDLDNPVLKTTSEIFLSSTAEGADLRTVDPETQARLEALL EAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMKAENSHN AGQVDTRSLAEACSDGDVNAVRKLLDEGRSVNEHTEEGESLLCLACSAGY YELAQVLLAMHANVEDRGNKGDITPLMAASSGGYLDIVKLLLLHDADVNS QSATGNTALTYACAGGFVDIVKVLLNEGANIEDHNENGHTPLMEAASAGH VEVARVLLDHGAGINTHSNEFKESALTLACYKGHLDMVRFLLEAGADQEH KTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGH VELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQ TEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLEL VKYLLASGANVHATTATGDTALTYACENGHTDVADVLLQAGADLDKQEDM KTILEGIDPAKHQVRVAFDACKLLRKE
    • Amino acids
      1 to 627
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKH1_HUMAN
    • ANKHD 1
    • ANKHD1
    • Ankyrin repeat and KH domain containing 1
    • Ankyrin repeat and KH domain containing protein 1
    • Ankyrin repeat and KH domain-containing protein 1
    • HIV-1 Vpr-binding ankyrin repeat protein
    • HIV1 Vpr binding ankyrin repeat protein
    • hMASK
    • KIAA1085
    • MASK
    • Multiple ankyrin repeats single KH domain
    • Multiple ankyrin repeats single KH domain homolog
    • PP2500
    • VBARP
    see all
  • Function
    May play a role as a scaffolding protein that may be associated with the abnormal phenotype of leukemia cells. Isoform 2 may possess an antiapoptotic effect and protect cells during normal cell survival through its regulation of caspases.
  • Tissue specificity
    Ubiquitous with high expression in cervix, spleen and brain. Expressed in hematopoietic cells with increased expression in leukemia cells. Isoform 2 is highly expressed in spleen with almost no expression in muscle and brain.
  • Sequence similarities
    Belongs to the mask family.
    Contains 25 ANK repeats.
    Contains 1 KH domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162876 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up