Recombinant Human ANKRD15 protein (ab161565)

Overview

  • Product name
    Recombinant Human ANKRD15 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCK CGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDD
    • Amino acids
      701 to 800
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKRD 15
    • Ankyrin repeat domain 15
    • Ankyrin repeat domain containing protein 15
    • Ankyrin repeat domain-containing protein 15
    • DKFZp451G231
    • KANK
    • KANK1
    • KANK1_HUMAN
    • KIAA0172
    • Kidney ankyrin repeat containing protein
    • Kidney ankyrin repeat-containing protein
    • KN motif and ankyrin repeat domain-containing protein 1
    • MGC43128
    see all
  • Function
    Involved in the control of cytoskeleton formation by regulating actin polymerization. Inhibits actin fiber formation and cell migration. Inhibits RhoA activity; the function involves phosphorylation through PI3K/Akt signaling and may depend on the competetive interaction with 14-3-3 adapter proteins to sequester them from active complexes. Inhibits the formation of lamellipodia but not of filopodia; the function may depend on the competetive interaction with BAIAP2 to block its association with activated RAC1. Inhibits fibronectin-mediated cell spreading; the function is partially mediated by BAIAP2. Inhibits neurite outgrowth. Involved in the establishment and persistence of cell polarity during directed cell movement in wound healing. In the nucleus, is involved in beta-catenin-dependent activation of transcription. Potential tumor suppressor for renal cell carcinoma.
  • Tissue specificity
    Widely expressed. Isoform 1 is predominantly expressed in heart and kidney. Isoform 2 probably is widely expressed at basic levels.
  • Involvement in disease
    Defects in KANK1 are the cause of cerebral palsy spastic quadriplegic type 2 (CPSQ2) [MIM:612900]. A non-progressive disorder of movement and/or posture resulting from defects in the developing central nervous system. Affected individuals manifest congenital hypotonia evolving over the first year to spastic quadriplegia with accompanying transient nystagmus and varying degrees of mental retardation. Neuroimaging shows brain atrophy and ventriculomegaly.
  • Sequence similarities
    Contains 5 ANK repeats.
  • Cellular localization
    Cell projection > ruffle membrane. Colocalizes with KIF21A in membrane ruffles; Cytoplasm. Nucleus. Cell projection > ruffle membrane. Shuttles between the cytoplasm and nucleus and Cytoplasm. Nucleus. Shuttles between the cytoplasm and nucleus.
  • Information by UniProt

Images

  • ab161565 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up