Recombinant Human ANKRD17 protein (ab161888)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDG AGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMN QLG
    • Amino acids
      2501 to 2603
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKRD 17
    • ANKRD17
    • Ankyrin repeat domain protein 17
    • Ankyrin repeat domain-containing protein 17
    • ANR17_HUMAN
    • FLJ22206
    • Gene trap ankyrin repeat
    • Gene trap ankyrin repeat protein
    • GTAR
    • KIAA0697
    • MASK2
    • NY BR 16
    • NY-BR-16
    • Serologically defined breast cancer antigen NY-BR-16
    see all
  • Function
    Could play pivotal roles in cell cycle and DNA regulation (PubMed:19150984). Involved in innate immune defense against viruse by positively regulating the viral dsRNA receptors DDX58 and IFIH1 signaling pathways (PubMed:22328336). Involves in NOD2- and NOD1-mediated responses to bacteria suggesting a role in innate antibacterial immune pathways too (PubMed:23711367). Target of enterovirus 71 which is the major etiological agent of HFMD (hand, foot and mouth disease) (PubMed:17276651). Could play a central role for the formation and/or maintenance of the blood vessels of the circulation system.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Contains 25 ANK repeats.
    Contains 1 KH domain.
  • Post-translational
    modifications
    Phosphorylated by CDK2.
  • Cellular localization
    Cytoplasm. Nucleus. Detected around the nucleolus. Localized on chromatin in a cell cycle-dependent manner.
  • Information by UniProt

Images

  • ab161888 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up