Recombinant Human ANKS1A protein (ab161591)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRATGASAAEMIETKS SKPVPKPRVGVRKSALEPPDMDQDAQSHASVSWVVDPKPDSKRSLS
    • Amino acids
      1037 to 1132
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANKS 1
    • ANKS 1A
    • ANKS1
    • ANKS1A
    • Ankyrin repeat and SAM domain containing 1
    • Ankyrin repeat and SAM domain containing protein 1A
    • Ankyrin repeat and SAM domain-containing protein 1A
    • Ankyrin repeat and sterile alpha motif domain containing 1A
    • ANS1A_HUMAN
    • KIAA0229
    • MGC42354
    • Odin
    see all
  • Function
    May play a negative role in growth factor receptor signaling pathways.
  • Tissue specificity
    Widely expressed (at protein level).
  • Sequence similarities
    Contains 6 ANK repeats.
    Contains 1 PID domain.
    Contains 2 SAM (sterile alpha motif) domains.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues in response to EGF and PDGF.
  • Cellular localization
    Cytoplasm. Cytoplasmic before and after growth factor treatment.
  • Information by UniProt

Images

  • ab161591 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up