Recombinant Human Annexin A13 protein (ab105616)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP27216
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGNRHAKASSPQGFDVDRDAKKLNKACKGM GTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTA LALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQR LFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSG DLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDL QGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALLH
    • Molecular weight38 kDa including tags
    • Amino acids1 to 316
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab105616 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Annexin A13
    • Annexin XIII
    • Annexin, intestine-specific
    • Annexin-13
    • ANX 13
    • ANX A13
    • ANX13
    • ANX13_HUMAN
    • ANXA13
    • Intestine Specific Annexin
    • Intestine-specific annexin
    • ISA
    • MGC150460
    see all
  • Tissue specificityGut specific.
  • Sequence similaritiesBelongs to the annexin family.
    Contains 4 annexin repeats.
  • DomainA pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Cellular localizationCell membrane. Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.
  • Information by UniProt

Recombinant Human Annexin A13 protein images

  • 15% SDS-PAGE analysis of 3µg ab105616.

References for Recombinant Human Annexin A13 protein (ab105616)

ab105616 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"