Recombinant Human Annexin A13 protein (ab105616)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGNRHAKASSPQGFDVDRDAKKLNKACKGM GTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTA LALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQR LFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSG DLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDL QGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALLH
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 316
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105616 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Annexin A13
    • Annexin XIII
    • Annexin, intestine-specific
    • Annexin-13
    • ANX 13
    • ANX A13
    • ANX13
    • ANX13_HUMAN
    • ANXA13
    • Intestine Specific Annexin
    • Intestine-specific annexin
    • ISA
    • MGC150460
    see all
  • Tissue specificity
    Gut specific.
  • Sequence similarities
    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain
    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Cellular localization
    Cell membrane. Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab105616.

References

ab105616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab105616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up