Recombinant Human Annexin V protein (ab73184)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQR QEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHAL KGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQ RMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGT RSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAY LAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI KGDTSGDYKKALLLLCGEDD
    • Molecular weight
      36 kDa

Specifications

Our Abpromise guarantee covers the use of ab73184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    Purity is >98% by SDS PAGE/HPLC analysis.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 130mM Arginine HCl, 0.02% Tween 80, 20mM PBS, pH 7.0

  • Reconstitution
    Reconstitute with 1.0ml distilled water at 30oC for 5 minutes. Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. Gently mix the vial after reconstitution. Storage in frost-free freezers is not recommended.

General Info

  • Alternative names
    • Anchorin CII
    • Annexin 5
    • Annexin A5
    • Annexin V
    • Annexin-5
    • ANX A5
    • ANX5
    • ANXA5
    • ANXA5_HUMAN
    • Calphobindin I
    • CBP-I
    • Endonexin II
    • ENX2
    • Lipocortin V
    • PAP I
    • PAP-I
    • Placental anticoagulant protein 4
    • Placental anticoagulant protein I
    • PLACENTAL PROTEIN 4
    • Pp4
    • Thromboplastin inhibitor
    • VAC-alpha
    • Vascular anticoagulant-alpha
    see all
  • Function
    This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
  • Involvement in disease
    Pregnancy loss, recurrent, 3
  • Sequence similarities
    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain
    The [IL]-x-C-x-x-[DE] motif is a proposed target motif for cysteine S-nitrosylation mediated by the iNOS-S100A8/A9 transnitrosylase complex.
    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Post-translational
    modifications
    S-nitrosylation is induced by interferon-gamma and oxidatively-modified low-densitity lipoprotein (LDL(ox)) possibly implicating the iNOS-S100A8/9 transnitrosylase complex.
  • Information by UniProt

References

ab73184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab73184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up