Recombinant Human Annexin V protein (ab73184)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQR QEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHAL KGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQ RMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGT RSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAY LAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI KGDTSGDYKKALLLLCGEDD
    • Molecular weight
      36 kDa

Specifications

Our Abpromise guarantee covers the use of ab73184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    Purity is >98% by SDS PAGE/HPLC analysis.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 130mM Arginine HCl, 0.02% Tween 80, 20mM PBS, pH 7.0

  • Reconstitution
    Reconstitute with 1.0ml distilled water at 30oC for 5 minutes. Care should be taken during reconstitution as the protein may appear as a film at the bottom of the vial. Gently mix the vial after reconstitution. Storage in frost-free freezers is not recommended.

General Info

  • Alternative names
    • Anchorin CII
    • Annexin 5
    • Annexin A5
    • Annexin V
    • Annexin-5
    • ANX A5
    • ANX5
    • ANXA5
    • ANXA5_HUMAN
    • Calphobindin I
    • CBP-I
    • Endonexin II
    • ENX2
    • Lipocortin V
    • PAP I
    • PAP-I
    • Placental anticoagulant protein 4
    • Placental anticoagulant protein I
    • PLACENTAL PROTEIN 4
    • Pp4
    • Thromboplastin inhibitor
    • VAC-alpha
    • Vascular anticoagulant-alpha
    see all
  • Function
    This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
  • Involvement in disease
    Pregnancy loss, recurrent, 3
  • Sequence similarities
    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain
    The [IL]-x-C-x-x-[DE] motif is a proposed target motif for cysteine S-nitrosylation mediated by the iNOS-S100A8/A9 transnitrosylase complex.
    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Post-translational
    modifications
    S-nitrosylation is induced by interferon-gamma and oxidatively-modified low-densitity lipoprotein (LDL(ox)) possibly implicating the iNOS-S100A8/9 transnitrosylase complex.
  • Information by UniProt

References for Recombinant Human Annexin V protein (ab73184)

ab73184 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab73184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up