Recombinant Human Annexin VIII protein (ab99215)

Overview

  • Product name
    Recombinant Human Annexin VIII protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAWWKSWIEQEGVTVKSSSHFNPDPDAETL YKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELS GKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLRE IMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLAL QDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIED SIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 327
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99215 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Annexin A8
    • Annexin VIII
    • Annexin-8
    • ANX8
    • Anxa8
    • ANXA8_HUMAN
    • VAC beta
    • VAC-beta
    • Vascular anticoagulant beta
    • Vascular anticoagulant-beta
    see all
  • Function
    This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
  • Sequence similarities
    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain
    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99215.

References

ab99215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up