Recombinant Human Annexin VIII protein (ab99215)

Overview

  • Product nameRecombinant Human Annexin VIII protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP13928
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAWWKSWIEQEGVTVKSSSHFNPDPDAETL YKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELS GKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLRE IMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLAL QDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIED SIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNI VSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP
    • Molecular weight39 kDa including tags
    • Amino acids1 to 327
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99215 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Annexin A8
    • Annexin VIII
    • Annexin-8
    • ANX8
    • Anxa8
    • ANXA8_HUMAN
    • VAC beta
    • VAC-beta
    • Vascular anticoagulant beta
    • Vascular anticoagulant-beta
    see all
  • FunctionThis protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
  • Sequence similaritiesBelongs to the annexin family.
    Contains 4 annexin repeats.
  • DomainA pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Information by UniProt

Recombinant Human Annexin VIII protein images

  • 15% SDS-PAGE analysis of 3µg ab99215.

References for Recombinant Human Annexin VIII protein (ab99215)

ab99215 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"