Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEK MPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG PWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFR YRR
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 153

Specifications

Our Abpromise guarantee covers the use of ab114317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANF
    • ANF_HUMAN
    • ANP
    • ATFB6
    • Atrial natriuretic factor
    • Atrial natriuretic peptide
    • Atriopeptin
    • Cardiodilatin
    • Cardiodilatin-related peptide
    • Cardionatrin
    • CDD
    • CDD ANF
    • CDD-ANF
    • CDP
    • Natriuretic peptide A
    • Natriuretic peptide precursor A
    • NPPA
    • PND
    • Prepronatriodilatin
    see all
  • Function
    Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
  • Involvement in disease
    Atrial standstill 2
    Atrial fibrillation, familial, 6
  • Sequence similarities
    Belongs to the natriuretic peptide family.
  • Post-translational
    modifications
    Cleaved by CORIN upon secretion to produce the functional hormone.
    Atrial natriuretic factor: Cleaved by MME. The cleavage initiates degradation of the factor and thereby regulate its activity.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114317 on a 12.5% gel stained with Coomassie Blue.

References

ab114317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up