Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEK MPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG PWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFR YRR
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 153

Specifications

Our Abpromise guarantee covers the use of ab114317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ANF
    • ANF_HUMAN
    • ANP
    • ATFB6
    • Atrial natriuretic factor
    • Atrial natriuretic peptide
    • Atriopeptin
    • Cardiodilatin
    • Cardiodilatin-related peptide
    • Cardionatrin
    • CDD
    • CDD ANF
    • CDD-ANF
    • CDP
    • Natriuretic peptide A
    • Natriuretic peptide precursor A
    • NPPA
    • PND
    • Prepronatriodilatin
    see all
  • Function
    Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
  • Involvement in disease
    Atrial standstill 2
    Atrial fibrillation, familial, 6
  • Sequence similarities
    Belongs to the natriuretic peptide family.
  • Post-translational
    modifications
    Cleaved by CORIN upon secretion to produce the functional hormone.
    Atrial natriuretic factor: Cleaved by MME. The cleavage initiates degradation of the factor and thereby regulate its activity.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human ANP protein images

  • SDS-PAGE analysis of ab114317 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human ANP protein (ab114317)

ab114317 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up