Overview

  • Product nameRecombinant Human ANP32C protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKI NGGLTS ISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKD LSTIEPLKQLENLK SLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYW DHKEAPYSDIEDHVEGLDDEEE GEHEEEYDEDAQVVEDEEGEEEEEEG EEEDVSGGDEEDEEGYNDGEVDGEEDEEEL GEEERGQKRK

Specifications

Our Abpromise guarantee covers the use of ab88178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88178 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • Acidic (leucine rich) nuclear phosphoprotein 32 family, member C
    • Acidic leucine-rich nuclear phosphoprotein 32 family member C
    • AN32C_HUMAN
    • ANP32 C
    • ANP32C
    • Phosphoprotein 32 related protein 1
    • Phosphoprotein 32-related protein 1
    • pp32 related 1
    • PP32R1
    • Tumorigenic protein pp32r1
    see all
  • Tissue specificityExpressed in activated stem cells, such as mobilized CD34+ cells and cord blood CD34+ cells, but not in resting bone marrow CD34+ cells. Expressed in a variety of neoplastic cell lines, mainly in prostatic adenocarcinoma cell lines. Not expressed in normal prostatic tissue.
  • Sequence similaritiesBelongs to the ANP32 family.
    Contains 4 LRR (leucine-rich) repeats.
  • Information by UniProt

References for Recombinant Human ANP32C protein (ab88178)

ab88178 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"