Recombinant Human Anterior Gradient 2 protein (ab151803)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP DGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKL LKTELVDHHHHHH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      21 to 175
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • AG 2
    • AG 2 protein
    • AG-2
    • AG2
    • AG2 protein
    • AGR 2
    • AGR2
    • AGR2_HUMAN
    • anterior gradient 2 homolog
    • Anterior gradient 2 homolog (Xenopus laevis)
    • Anterior gradient 2, protein disulphide isomerase family member
    • Anterior gradient 2, Xenopus, homolog of
    • Anterior gradient homolog 2
    • Anterior gradient protein 2 homolog
    • Epididymis secretory protein Li 116
    • GOB 4
    • GOB4
    • HAG 2
    • hAG-2
    • hAG2
    • HAG2/R
    • HEL S 116
    • HPC 8
    • hPC8
    • PDIA17
    • Protein disulfide isomerase family A member 17
    • secreted cement gland homolog
    • Secreted cement gland protein XAG 2 homolog
    • Secreted cement gland protein XAG-2 homolog
    • Secreted cement gland protein XAG2 homolog
    • XAG 2
    • XAG2
    see all
  • Function
    Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells (By similarity). Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth.
  • Tissue specificity
    Expressed strongly in trachea, lung, stomach, colon, prostate and small intestine. Expressed weakly in pituitary gland, salivary gland, mammary gland, bladder, appendix, ovary, fetal lung, uterus, pancreas, kidney, fetal kidney, testis, placenta, thyroid gland and in estrogen receptor (ER)-positive breast cancer cell lines.
  • Sequence similarities
    Belongs to the AGR family.
  • Cellular localization
    Secreted. Endoplasmic reticulum.
  • Information by UniProt

References

ab151803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up