Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RAEFTQMWRHLKEVELPKAPIFLSSTFNYNGSTLAAVHATPRGLRSGDRA TWMALYHNISGVGLFLHPVGLELLLDHRALDPAHWTVQQVFYLGHYYADL
    • Amino acids
      169 to 268
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amine oxidase [copper containing]
    • Amine oxidase [copper-containing]
    • Amine oxidase copper containing 2
    • Amine oxidase copper containing 2 (retina specific)
    • AOC2
    • AOC2_HUMAN
    • DAO2
    • RAO
    • Retina specific copper amine oxidase
    • Retina-specific copper amine oxidase
    • Semicarbazide-sensitive amine oxidase
    • SSAO
    see all
  • Function
    Has a monoamine oxidase activity with substrate specificity for 2-phenylethylamine and tryptamine. May play a role in adipogenesis. May be a critical modulator of signal transmission in retina.
  • Tissue specificity
    Expressed in many tissues with much higher expression in retina. Isoform 1 and isoform 2 are expressed in adipose tissue, whereas isoform 1 only seems to be present in thymus, and isoform 2 only in testis.
  • Sequence similarities
    Belongs to the copper/topaquinone oxidase family.
  • Post-translational
    modifications
    Topaquinone (TPQ) is generated by copper-dependent autoxidation of a specific tyrosyl residue.
  • Cellular localization
    Cell membrane. Present on the surface of the cells and Cytoplasm. Either not translocated to the plasma membrane or below detection level.
  • Information by UniProt

Images

  • ab157895 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up