Recombinant Human AP1+2 beta protein (ab157866)

Overview

  • Product name
    Recombinant Human AP1+2 beta protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSAL FPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNP LIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHD INAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLN PQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSH ANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQY VALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQAN IAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQ TKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIW IVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQ ELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISE ETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASS ESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSS VQMGAVDLLGGGLDSLIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTS GVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQ VMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTVGSVMKME PLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKMDRQMFLATWKDIPNEN EAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIW VLAELRIQPGNPSCTLSLKCRAPEVSQHVYQAYETILKN
    • Amino acids
      1 to 939
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adaptin, beta 2 (beta)
    • Adaptor protein complex AP-1 subunit beta-1
    • Adaptor related protein complex 1, beta 1 subunit
    • Adaptor related protein complex 2, beta 1 subunit
    • Adaptor-related protein complex 1 subunit beta-1
    • ADTB1
    • ADTB2
    • AP 1 complex subunit beta 1
    • AP 2 complex subunit beta 1
    • AP-1 complex subunit beta-1
    • AP1 Beta
    • AP1B1
    • AP1B1_HUMAN
    • AP2 Beta
    • AP2B1
    • Beta-1-adaptin
    • Beta-adaptin 1
    • Beta1 adaptin
    • Beta2 adaptin
    • CLAPB1
    • CLAPB2
    • Clathrin assembly protein complex 1 beta large chain
    • Golgi adaptor HA1/AP1 adaptin beta subunit
    see all
  • Function
    Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the adaptor complexes large subunit family.
  • Cellular localization
    Golgi apparatus. Cytoplasmic vesicle, clathrin-coated vesicle membrane. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
  • Information by UniProt

Images

  • ab157866 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up