Overview

  • Product name
    Recombinant Human AP1M1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPIL AHGGVRFMWIKHNNLYLVATSKKN
    • Amino acids
      1 to 74
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adaptor protein complex AP-1 mu-1 subunit
    • Adaptor-related protein complex 1 mu-1 subunit
    • AP-1 complex subunit mu-1
    • AP-mu chain family member mu1A
    • Ap1m1
    • AP1M1_HUMAN
    • AP47
    • CLAPM2
    • Clathrin adaptor protein AP47
    • Clathrin assembly protein complex 1 medium chain
    • Clathrin assembly protein complex 1 medium chain 1
    • Clathrin assembly protein complex AP1 mu subunit
    • Clathrin coat assembly protein AP47
    • Clathrin coat-associated protein AP47
    • CLTNM
    • Golgi adaptor AP 1 47 kDa protein
    • Golgi adaptor HA1/AP1 adaptin mu-1 subunit
    • HA1 47 kDa subunit
    • MU 1A
    • Mu-adaptin 1
    • Mu1A-adaptin
    see all
  • Function
    Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
  • Sequence similarities
    Belongs to the adaptor complexes medium subunit family.
    Contains 1 MHD (mu homology) domain.
  • Post-translational
    modifications
    Phosphorylation of membrane-bound AP1M1/AP1M2 increases its affinity for sorting signals.
  • Cellular localization
    Golgi apparatus. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
  • Information by UniProt

Images

  • ab160257 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up