Overview

  • Product name
    Recombinant Human AP1S2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMQFMLLFSRQGKLRLQKWYVPLSDKEKKKI TRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITL EIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNV LKAIEQADLLQEEAETPRSVLEEIGLT
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 157
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab108122 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Adapter related protein complex 1 sigma 1B subunit
    • Adapter-related protein complex 1 sigma-1B subunit
    • Adaptor protein complex AP 1 sigma 1B subunit
    • Adaptor protein complex AP-1 sigma-1B subunit
    • Adaptor related protein complex 1 sigma 2 subunit
    • AP 1 complex subunit sigma 2
    • AP-1 complex subunit sigma-2
    • ap1s2
    • AP1S2_HUMAN
    • Clathrin adaptor complex AP1 sigma 1B subunit
    • Clathrin assembly protein complex 1 sigma 1B small chain
    • Clathrin assembly protein complex 1 sigma-1B small chain
    • Clathrin associated assembly adaptor protein small 1 like
    • DC22
    • Golgi adaptor HA1 AP1 adaptin sigma 1B subunit
    • Golgi adaptor HA1/AP1 adaptin sigma-1B subunit
    • mental retardation X linked 59
    • MGC:1902
    • MRX59
    • Sigma 1B subunit of AP 1 clathrin
    • Sigma 1B subunit of AP-1 clathrin
    • Sigma adaptin 1B
    • Sigma-adaptin 1B
    • SIGMA1B
    • Sigma1B adaptin
    • Sigma1B-adaptin
    see all
  • Function
    Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in AP1S2 are the cause of mental retardation X-linked type 59 (MRX59) [MIM:300630]. It is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific X-linked mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic X-linked mental retardation. MRX59 consists of a mild-to-profound mental retardation. Other features includes hypotonia early in life and delay in walking.
  • Sequence similarities
    Belongs to the adaptor complexes small subunit family.
  • Cellular localization
    Golgi apparatus. Cytoplasmic vesicle membrane. Membrane > clathrin-coated pit. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab108122.

References

ab108122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up