Recombinant Human AP2 alpha protein (ab114726)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP05549
    • SpeciesHuman
    • SequenceSGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPH AIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGV VNPNEVF
    • Molecular weight37 kDa including tags
    • Amino acids99 to 205

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Activating enhancer binding protein 2 alpha
    • Activating enhancer-binding protein 2-alpha
    • Activator protein 2
    • AP 2 transcription factor
    • AP 2alpha
    • AP-2
    • AP-2 transcription factor
    • AP2
    • AP2 Transcription Factor
    • AP2-alpha
    • AP2A_HUMAN
    • AP2TF
    • BOFS
    • FLJ51761
    • TFAP 2
    • TFAP 2A
    • TFAP2
    • TFAP2A
    • Transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha)
    • Transcription factor AP-2-alpha
    • Transcription factor AP2 alpha
    see all
  • FunctionSequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle.
  • Involvement in diseaseDefects in TFAP2A are the cause of branchiooculofacial syndrome (BOFS) [MIM:113620]; also known as branchial clefts with characteristic facies, growth retardation, imperforate nasolacrimal duct, and premature aging or lip pseudocleft-hemangiomatous branchial cyst syndrome. BOFS is a rare autosomal dominant cleft palate craniofacial disorder with variable expressivity. The major features include cutaneous anomalies, ocular anomalies, characteristic facial appearance (malformed pinnae, oral clefts), and, less commonly, renal and ectodermal (dental and hair) anomalies.
  • Sequence similaritiesBelongs to the AP-2 family.
  • DomainThe WW-binding motif mediates interaction with WWOX.
  • Post-translational
    modifications
    Sumoylated on Lys-10; which inhibits transcriptional activity.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human AP2 alpha protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human AP2 alpha protein (ab114726)

ab114726 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"