Recombinant Human AP2 alpha protein (ab114726)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPH AIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGV VNPNEVF
    • Molecular weight
      37 kDa including tags
    • Amino acids
      99 to 205

Specifications

Our Abpromise guarantee covers the use of ab114726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Activating enhancer binding protein 2 alpha
    • Activating enhancer-binding protein 2-alpha
    • Activator protein 2
    • AP 2 transcription factor
    • AP 2alpha
    • AP-2
    • AP-2 transcription factor
    • AP2
    • AP2 Transcription Factor
    • AP2-alpha
    • AP2A_HUMAN
    • AP2TF
    • BOFS
    • FLJ51761
    • TFAP 2
    • TFAP 2A
    • TFAP2
    • TFAP2A
    • Transcription factor AP 2 alpha (activating enhancer binding protein 2 alpha)
    • Transcription factor AP-2-alpha
    • Transcription factor AP2 alpha
    see all
  • Function
    Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle.
  • Involvement in disease
    Defects in TFAP2A are the cause of branchiooculofacial syndrome (BOFS) [MIM:113620]; also known as branchial clefts with characteristic facies, growth retardation, imperforate nasolacrimal duct, and premature aging or lip pseudocleft-hemangiomatous branchial cyst syndrome. BOFS is a rare autosomal dominant cleft palate craniofacial disorder with variable expressivity. The major features include cutaneous anomalies, ocular anomalies, characteristic facial appearance (malformed pinnae, oral clefts), and, less commonly, renal and ectodermal (dental and hair) anomalies.
  • Sequence similarities
    Belongs to the AP-2 family.
  • Domain
    The WW-binding motif mediates interaction with WWOX.
  • Post-translational
    modifications
    Sumoylated on Lys-10; which inhibits transcriptional activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up