Recombinant Human AP2 gamma protein (ab152738)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCL SHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNK TLEKMEKHRK
    • Molecular weight
      38 kDa including tags
    • Amino acids
      341 to 450

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activating enhancer binding protein 2 gamma
    • Activating enhancer-binding protein 2 gamma
    • AP2-gamma
    • AP2C_HUMAN
    • AP2g
    • AP2gamma
    • ERF 1
    • ERF1
    • Estrogen receptor factor 1
    • hAP 2g
    • hAP2g
    • TFAP 2C
    • TFAP 2G
    • Tfap2c
    • TFAP2G
    • Transcription factor AP 2 gamma
    • Transcription factor AP 2 gamma (activating enhancer binding protein 2 gamma)
    • Transcription factor AP-2 gamma
    • Transcription factor ERF 1
    • Transcription factor ERF-1
    • Transcription factor ERF1
    see all
  • Function
    Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC.
  • Sequence similarities
    Belongs to the AP-2 family.
  • Domain
    The WW-binding motif mediates interaction with WWOX.
  • Post-translational
    modifications
    Sumoylated on Lys-10; which inhibits transcriptional activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152378 stained with Coomassie Blue.

References

ab152738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up