Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEA QNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQF
    • Amino acids
      94 to 192
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adapter related protein complex 3 sigma 2 subunit
    • Adapter-related protein complex 3 sigma-2 subunit
    • AP 3 complex sigma 3B subunit
    • AP-3 complex subunit sigma-2
    • AP-3 complex subunit sigma-3B
    • Ap3s2
    • AP3S2_HUMAN
    • Clathrin adaptor complex AP3 sigma 3b subunit
    • Clathrin associated/assembly/adaptor protein, small 4 22-kD
    • Sigma 3B adaptin
    • Sigma adaptin 3b
    • Sigma-3B-adaptin
    • Sigma-adaptin 3b
    • Sigma3B-adaptin
    see all
  • Function
    Part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.
  • Tissue specificity
    Present in all adult tissues examined.
  • Sequence similarities
    Belongs to the adaptor complexes small subunit family.
  • Cellular localization
    Golgi apparatus. Cytoplasmic vesicle membrane. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
  • Information by UniProt

Images

  • ab160897 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up