Overview

  • Product name
    Recombinant Human AP4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGA QAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPECGRRFRHAPFL ALHRQVHAAA
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60 kDa origin specific DNA binding protein
    • 60 kDa replication initiation region protein
    • ATT binding protein
    • DHFR oribeta binding protein RIP60
    • H_DJ0584D14.12
    • REPIN1
    • Replication initiation region protein (60kD)
    • Replication initiator 1
    • RIP60
    • Zfp464
    • Zinc finger protein 464 (RIP60)
    • Zinc finger proten AP4
    • ZNF464
    see all
  • Relevance
    AP4 (Replication initiator 1) is a sequence-specific double-stranded DNA-binding protein required for initiation of chromosomal DNA replication. It binds on 5'-ATT-3' reiterated sequences downstream of the origin of bidirectional replication (OBR) and a second, homologous ATT sequence of opposite orientation situated within the OBR zone. AP4 facilitates DNA bending.
  • Cellular localization
    Nuclear

Images

  • ab162240 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up