Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14727
    • SpeciesHuman
    • SequenceGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGY IKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
    • Molecular weight37 kDa including tags
    • Amino acids1138 to 1237
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APAF 1
    • Apaf-1
    • APAF_HUMAN
    • Apaf1
    • Apoptotic peptidase activating factor 1
    • Apoptotic protease activating factor
    • Apoptotic protease activating factor 1
    • Apoptotic protease-activating factor 1
    • CED 4
    • CED4
    • KIAA0413
    see all
  • FunctionOligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP. Isoform 6 is less effective in inducing apoptosis.
  • Tissue specificityUbiquitous. Highest levels of expression in adult spleen and peripheral blood leukocytes, and in fetal brain, kidney and lung. Isoform 1 is expressed in heart, kidney and liver.
  • Sequence similaritiesContains 1 CARD domain.
    Contains 1 NB-ARC domain.
    Contains 13 WD repeats.
  • DomainThe CARD domain mediates interaction with APIP.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human APAF1 protein images

  • Coomassie Blue stained 12.5% SDS page analysis of ab112251

References for Recombinant Human APAF1 protein (ab112251)

ab112251 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"