Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPV VSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYG
    • Amino acids
      1 to 100
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APEG1
    • Aortic preferentially expressed gene 1
    • Aortic preferentially expressed protein 1
    • APEG 1
    • APEG-1
    • BPEG
    • KIAA1297
    • MGC12676
    • Nuclear protein marker for differentiated aortic smooth muscle and down regulated with vascular injury
    • OTTHUMP00000196351
    • OTTHUMP00000196352
    • OTTHUMP00000196353
    • speG
    • SPEG complex locus
    • SPEG_HUMAN
    • SPEGalpha
    • SPEGbeta
    • striated muscle preferentially expressed protein kinase
    • Striated muscle preferentially expressed protein kinase
    see all
  • Function
    Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.
  • Tissue specificity
    Isoform 1 is preferentially expressed in striated muscle. Non-kinase form such as isoform 3 is predominantly expressed in the aorta. Isoform 3 appears to be expressed only in highly differentiated ASMC in normal vessel walls and down-regulated in dedifferentiated ASMC in vivo. In response to vascular injuries ASMC dedifferentiate and change from a quiescent and contractile phenotype to a proliferative and synthetic phenotype. This proliferation of vascular smooth muscle cells is one of the most prominent features of atherosclerosis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 2 fibronectin type-III domains.
    Contains 9 Ig-like (immunoglobulin-like) domains.
    Contains 2 protein kinase domains.
  • Post-translational
    modifications
    May be autophosphorylated. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160930 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up