Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGD TKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQL FIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
    • Amino acids
      1 to 140
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APG12-like
    • APG12L
    • ATG12
    • ATG12 autophagy related 12 homolog
    • ATG12 autophagy related 12 homolog (S. cerevisiae)
    • ATG12_HUMAN
    • Autophagy 12
    • Autophagy-related protein 12
    • FBR93
    • HAPG12
    • Ubiquitin-like protein ATG12
    see all
  • Function
    Ubiquitin-like protein required for autophagy. Conjugated to ATG3 and ATG5.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the ATG12 family.
  • Domain
    Shares weak sequence similarity with ubiquitin family, but contains an 'ubiquitin superfold' and the C-terminal Gly is required for isopeptide linkage.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab160355 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up