Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHC PTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610016C12Rik
    • Apg 3
    • APG3
    • APG3 autophagy 3 like
    • APG3 like
    • APG3, S. cerevisiae, homolog of
    • APG3-like
    • APG3L
    • Apg3p
    • ATG 3
    • ATG3
    • ATG3 autophagy related 3 homolog
    • ATG3 autophagy related 3 homolog (S. cerevisiae)
    • ATG3_HUMAN
    • Autophagy 3, S. cerevisiae, homolog of
    • Autophagy Apg3p/Aut1p like
    • autophagy related 3
    • Autophagy related protein 3
    • Autophagy-related protein 3
    • DKFZp564M1178
    • FLJ22125
    • hApg3
    • MGC15201
    • OTTHUMP00000214547
    • OTTHUMP00000214548
    • PC3 96
    • Protein PC3-96
    • Ubiquitin-like-conjugating enzyme ATG3
    see all
  • Function
    E2-like enzyme involved in autophagy and mitochondrial homeostasis. Catalyzes the conjugation of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A) to phosphatidylethanolamine (PE). PE-conjugation to ATG8-like proteins is essential for autophagy. Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3.
  • Tissue specificity
    Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta.
  • Sequence similarities
    Belongs to the ATG3 family.
  • Post-translational
    modifications
    Conjugated to ATG12 at Lys-243. ATG12-conjugation plays a role in regulation of mitochondrial homeostasis and cell death, while it is not involved in PE-conjugation to ATG8-like proteins and autophagy.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163838 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up