Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGY YYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810013K23Rik
    • Apg 7
    • APG7 autophagy 7 like
    • APG7 autophagy 7-like (S. cerevisiae)
    • APG7 like
    • APG7, S. cerevisiae, homolog of
    • APG7-like
    • APG7L
    • ATG 7
    • ATG12-activating enzyme E1 ATG7
    • ATG7
    • ATG7 autophagy related 7 homolog
    • ATG7 autophagy related 7 homolog (S. cerevisiae)
    • ATG7_HUMAN
    • Atg7l
    • Autophagy 7, S. cerevisiae, homolog of
    • Autophagy related protein 7
    • Autophagy-related 7 (yeast)
    • Autophagy-related protein 7
    • DKFZp434N0735
    • GSA 7
    • GSA7
    • hAGP7
    • Ubiquitin activating enzyme E1 like protein
    • Ubiquitin-activating enzyme E1-like protein
    • Ubiquitin-like modifier-activating enzyme ATG7
    see all
  • Function
    E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes membranes. Required for autophagic death induced by caspase-8 inhibition. Required for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Modulates p53/TP53 activity to regulate cell cycle and survival during metabolic stress. Plays also a key role in the maintenance of axonal homeostasis, the prevention of axonal degeneration, the maintenance of hematopoietic stem cells, the formation of Paneth cell granules, as well as in adipose differentiation.
  • Tissue specificity
    Widely expressed, especially in kidney, liver, lymph nodes and bone marrow.
  • Sequence similarities
    Belongs to the ATG7 family.
  • Domain
    The C-terminal part of the protein is essential for the dimerization and interaction with ATG3 and ATG12.
    The N-terminal FAP motif (residues 15 to 17) is essential for the formation of the ATG89-PE and ATG5-ATG12 conjugates.
  • Post-translational
    modifications
    Acetylated by EP300.
  • Cellular localization
    Cytoplasm. Preautophagosomal structure. Localizes also to discrete punctae along the ciliary axoneme and to the base of the ciliary axoneme.
  • Information by UniProt

Images

  • ab153097 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up