Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQY CQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVS DVLLVPEKCQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      41 to 150

Specifications

Our Abpromise guarantee covers the use of ab114601 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • amyloid beta (A4) precursor like protein 2
    • Amyloid like protein 2
    • Amyloid precursor protein homolog HSD 2
    • amyloid precursor protein homolog HSD2
    • Amyloid protein homolog
    • Amyloid-like protein 2
    • APLP-2
    • Aplp2
    • APLP2_HUMAN
    • APPH
    • APPL2
    • CDEBP
    • CDEI box binding protein
    • CDEI box-binding protein
    see all
  • Function
    May play a role in the regulation of hemostasis. The soluble form may have inhibitory properties towards coagulation factors. May interact with cellular G-protein signaling pathways. May bind to the DNA 5'-GTCACATG-3'(CDEI box). Inhibits trypsin, chymotrypsin, plasmin, factor XIA and plasma and glandular kallikrein.
  • Tissue specificity
    Expressed in placenta, brain, heart, lung, liver, kidney and endothelial tissues.
  • Sequence similarities
    Belongs to the APP family.
    Contains 1 BPTI/Kunitz inhibitor domain.
  • Post-translational
    modifications
    The BPTI/Kunitz inhibitor domain is O-glycosylated.
  • Cellular localization
    Cell membrane. Nucleus.
  • Information by UniProt

Recombinant Human APLP2 protein images

  • ab114601 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human APLP2 protein (ab114601)

ab114601 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114601.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up