Recombinant Human APOBEC1 protein (ab116768)

Overview

  • Product nameRecombinant Human APOBEC1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41238
    • SpeciesHuman
    • SequenceSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCII LSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR
    • Molecular weight37 kDa including tags
    • Amino acids137 to 236

Specifications

Our Abpromise guarantee covers the use of ab116768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABEC1_HUMAN
    • APOBEC 1
    • APOBEC1
    • Apolipoprotein B mRNA editing enzyme
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide 1
    • Apolipoprotein B mRNA editing enzyme complex 1
    • Apolipoprotein B mRNA-editing enzyme 1
    • BEDP
    • C->U-editing enzyme APOBEC-1
    • CDAR1
    • EC 3.5.4.
    • HEPR
    see all
  • FunctionCatalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. Also involved in CGA (Arg) to UGA (Stop) editing in the NF1 mRNA.
  • Tissue specificityExpressed exclusively in the small intestine.
  • Sequence similaritiesBelongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

Recombinant Human APOBEC1 protein images

  • 12.5% SDS-PAGE showing ab116768 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human APOBEC1 protein (ab116768)

ab116768 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"