Recombinant Human APOBEC3C protein (ab162155)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ
    • Amino acids
      91 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A3C
    • ABC3C_HUMAN
    • APOBEC1 like
    • APOBEC1-like
    • APOBEC1L
    • APOBEC3C
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3C
    • ARDC2
    • ARDC4
    • ARP5
    • bK150C2.3
    • DNA dC >dU editing enzyme APOBEC 3C
    • MGC19485
    • PBI
    • Phorbolin I
    • Phorbolin I protein
    • Probable DNA dC dU editing enzyme APOBEC 3C
    • Probable DNA dC->dU-editing enzyme APOBEC-3C
    see all
  • Function
    Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
  • Tissue specificity
    Expressed in spleen, testes, peripherical blood lymphocytes, heart, thymus, prostate and ovary.
  • Sequence similarities
    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Information by UniProt

Images

  • ab162155 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up