Recombinant Human APOBEC3G protein (ab163725)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDP DYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLP KY
    • Amino acids
      80 to 181
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A3G
    • ABC3G_HUMAN
    • APOBEC related cytidine deaminase
    • APOBEC related protein
    • APOBEC-related cytidine deaminase
    • APOBEC-related protein
    • APOBEC-related protein 9
    • APOBEC3G
    • Apolipoprotein B editing enzyme catalytic polypeptide like 3G
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide 3G
    • Apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3G
    • Apolipoprotein B mRNA editing enzyme catalytic subunit 3G
    • apolipoprotein B mRNA editing enzyme cytidine deaminase
    • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like
    • ARCD
    • ARP-9
    • ARP9
    • bK150C2.7
    • CEM-15
    • CEM15
    • deoxycytidine deaminase
    • dJ494G10.1
    • DNA dC dU editing enzyme APOBEC 3G
    • DNA dC->dU editing enzyme
    • DNA dC->dU-editing enzyme APOBEC-3G
    • EC 3.5.4.
    • FLJ12740
    • MDS019
    • OTTHUMP00000028911
    • phorbolin-like protein
    • phorbolin-like protein MDS019
    see all
  • Function
    DNA deaminase (cytidine deaminase) that mediates a form of innate resistance to retroviral infections (at least to HIV-1 infection) by triggering G-to-A hypermutation in the newly synthesized viral DNA. The replacements C-to-U in the minus strand DNA of HIV-1 during reverse transcription, leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. Modification of both DNA strands is not excluded. This antiviral activity is neutralized by the virion infectivity factor (VIF), that prevents the incorporation of APOBEC3G into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. APOBEC3G binds a variety of RNAs, but does not display detectable APOB, NF1 and NAT1 mRNA editing.
  • Tissue specificity
    Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid and non-lymphoid cell lines.
  • Sequence similarities
    Belongs to the cytidine and deoxycytidylate deaminase family.
  • Post-translational
    modifications
    Ubiquitinated in the presence of HIV-1 VIF. Association with VIF targets the protein for proteolysis by the ubiquitin-dependent proteasome pathway.
  • Cellular localization
    Cytoplasm. Nucleus. Mainly cytoplasmic. Small amount are found in the nucleus. During HIV-1 infection, virion-encapsidated in absence of HIV-1 VIF.
  • Information by UniProt

Images

  • ab163725 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up