Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEAD ALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLR ALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTA AGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMR DITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQ AERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSAS AEELRRQAQELEENLMELTQIYQRLNPCHTH
    • Amino acids
      1 to 331
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ApoL III
    • ApoL-III
    • APOL3
    • APOL3_HUMAN
    • APOLIII
    • Apolipoprotein L 3
    • Apolipoprotein L III
    • Apolipoprotein L-III
    • Apolipoprotein L3
    • Apolipoprotein LIII
    • CG12 1
    • CG12_1
    • CG121
    • TNF inducible protein CG12 1
    • TNF-inducible protein CG12-1
    see all
  • Function
    May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.
  • Tissue specificity
    Widely expressed; the highest levels are in prostate, lung and placenta; also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland; levels are low in brain, heart, fetal liver, pancreas and testis.
  • Sequence similarities
    Belongs to the apolipoprotein L family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164301 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up