Recombinant Human Apolipoprotein F (ab116968)

Overview

  • Product name
    Recombinant Human Apolipoprotein F
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKFL VSLALRNDALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRS TERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQL LPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVS DLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI
    • Molecular weight
      58 kDa including tags
    • Amino acids
      37 to 327

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apo-F
    • Apof
    • APOF_HUMAN
    • Apolipoprotein F
    • DKFZp781G18150
    • Lipid transfer inhibitor protein
    • LTIP
    • MGC22520
    see all
  • Function
    Minor apolipoprotein that associates with LDL. Inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Also associates to a lesser degree with VLDL, Apo-AI and Apo-AII.
  • Tissue specificity
    Expressed by the liver and secreted in plasma.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116968 at approximately 58.01kDa stained with Coomassie Blue.

References

ab116968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up