Recombinant Human Apolipoprotein F (ab116968)

Overview

  • Product nameRecombinant Human Apolipoprotein F
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13790
    • SpeciesHuman
    • SequenceTSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKFL VSLALRNDALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRS TERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQL LPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVS DLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI
    • Molecular weight58 kDa including tags
    • Amino acids37 to 327

Specifications

Our Abpromise guarantee covers the use of ab116968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apo-F
    • Apof
    • APOF_HUMAN
    • Apolipoprotein F
    • DKFZp781G18150
    • Lipid transfer inhibitor protein
    • LTIP
    • MGC22520
    see all
  • FunctionMinor apolipoprotein that associates with LDL. Inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Also associates to a lesser degree with VLDL, Apo-AI and Apo-AII.
  • Tissue specificityExpressed by the liver and secreted in plasma.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Apolipoprotein F images

  • 12.5% SDS-PAGE showing ab116968 at approximately 58.01kDa stained with Coomassie Blue.

References for Recombinant Human Apolipoprotein F (ab116968)

ab116968 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"