Recombinant Human Apolipoprotein L 1 (ab152886)

Overview

  • Product name
    Recombinant Human Apolipoprotein L 1
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSK PLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAA AELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSE LEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFT EGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA
    • Molecular weight
      52 kDa including tags
    • Amino acids
      1 to 238

Specifications

Our Abpromise guarantee covers the use of ab152886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APO L
    • Apo-L
    • ApoL
    • APOL I
    • ApoL-I
    • APOL1
    • APOL1_HUMAN
    • APOLI
    • Apolipoprotein L
    • Apolipoprotein L I
    • Apolipoprotein L-I
    • Apolipoprotein L1
    • FSGS4
    see all
  • Function
    May play a role in lipid exchange and transport throughout the body. May participate in reverse cholesterol transport from peripheral cells to the liver.
  • Tissue specificity
    Plasma. Found on APOA-I-containing high density lipoprotein (HDL3). Expressed in pancreas, lung, prostate, liver, placenta and spleen.
  • Involvement in disease
    Defects in APOL1 are the cause of focal segmental glomerulosclerosis type 4 (FSGS4) [MIM:612551]. It is a renal pathology defined by the presence of segmental sclerosis in glomeruli and resulting in proteinuria, reduced glomerular filtration rate and edema. Renal insufficiency often progresses to end-stage renal disease, a highly morbid state requiring either dialysis therapy or kidney transplantation.
  • Sequence similarities
    Belongs to the apolipoprotein L family.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152886 stained with Coomassie Blue

References

ab152886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up