Recombinant Human Apolipoprotein M (ab117188)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMCPEHSQLTTLGVDGKEFPEVHLGQWYFIA GAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWI YHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSP HPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
    • Molecular weight
      21 kDa including tags
    • Amino acids
      23 to 188
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab117188 is purified by standard chromatography.
  • Form
    Liquid
  • Additional notes
    Although stable at 4°C for 1 week, ab117188 should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • Apo M
    • Apo-M
    • Apolipoprotein M
    • ApoM
    • APOM_HUMAN
    • G3A
    • HSPC336
    • MGC22400
    • NG20
    • NG20 like protein
    • Protein G3a
    see all
  • Function
    Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid.
  • Tissue specificity
    Plasma protein. Expressed in liver and kidney.
  • Sequence similarities
    Belongs to the calycin superfamily. Lipocalin family. Highly divergent.
  • Cellular localization
    Secreted. Present in high density lipoprotein (HDL) and to a lesser extent in triglyceride-rich lipoproteins (TGRLP) and low density lipoproteins.
  • Information by UniProt

References for Recombinant Human Apolipoprotein M (ab117188)

ab117188 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up