Recombinant Human Apolipoprotein M (ab117188)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95445
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCPEHSQLTTLGVDGKEFPEVHLGQWYFIA GAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWI YHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSP HPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
    • Molecular weight21 kDa including tags
    • Amino acids23 to 188
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab117188 is purified by standard chromatography.
  • FormLiquid
  • Additional notesAlthough stable at 4°C for 1 week, ab117188 should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names
    • Apo M
    • Apo-M
    • Apolipoprotein M
    • ApoM
    • APOM_HUMAN
    • G3A
    • HSPC336
    • MGC22400
    • NG20
    • NG20 like protein
    • Protein G3a
    see all
  • FunctionProbably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid.
  • Tissue specificityPlasma protein. Expressed in liver and kidney.
  • Sequence similaritiesBelongs to the calycin superfamily. Lipocalin family. Highly divergent.
  • Cellular localizationSecreted. Present in high density lipoprotein (HDL) and to a lesser extent in triglyceride-rich lipoproteins (TGRLP) and low density lipoproteins.
  • Information by UniProt

References for Recombinant Human Apolipoprotein M (ab117188)

ab117188 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"